Protein Info for ECD_02583 in Escherichia coli BL21

Annotation: methyl-directed mismatch repair protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 853 TIGR01070: DNA mismatch repair protein MutS" amino acids 10 to 850 (841 residues), 1387.7 bits, see alignment E=0 PF01624: MutS_I" amino acids 11 to 122 (112 residues), 149.1 bits, see alignment E=1.4e-47 PF05188: MutS_II" amino acids 131 to 256 (126 residues), 129.5 bits, see alignment E=2.9e-41 PF05192: MutS_III" amino acids 272 to 559 (288 residues), 175 bits, see alignment E=5.9e-55 PF05190: MutS_IV" amino acids 428 to 517 (90 residues), 105 bits, see alignment E=5.3e-34 PF00488: MutS_V" amino acids 610 to 797 (188 residues), 300.2 bits, see alignment E=1.8e-93

Best Hits

Swiss-Prot: 100% identical to MUTS_ECO55: DNA mismatch repair protein MutS (mutS) from Escherichia coli (strain 55989 / EAEC)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 99% identity to ecg:E2348C_2999)

MetaCyc: 100% identical to DNA mismatch repair protein MutS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (853 amino acids)

>ECD_02583 methyl-directed mismatch repair protein (Escherichia coli BL21)
MSAIENFDAHTPMMQQYLRLKAQHPEILLFYRMGDFYELFYDDAKRASQLLDISLTKRGA
SAGEPIPMAGIPYHAVENYLAKLVNQGESVAICEQIGDPATSKGPVERKVVRIVTPGTIS
DEALLQERQDNLLAAIWQDSKGFGYATLDISSGRFRLSEPADRETMAAELQRTNPAELLY
AEDFAEMSLIEGRRGLRRRPLWEFEIDTARQQLNLQFGTRDLVGFGVENAPRGLCAAGCL
LQYAKDTQRTTLPHIRSITMEREQDSIIMDAATRRNLEITQNLAGGAENTLASVLDCTVT
PMGSRMLKRWLHMPVRDTRVLLERQQTIGALQDFTAGLQPVLRQVGDLERILARLALRTA
RPRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAIIDTPPVLVR
DGGVIASGYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYYIQISRG
QSHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPHLE
ALQQSASALAELDVLVNLAERAYTLNYTCPTFIDKPGIRITEGRHPVVEQVLNEPFIANP
LNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPIDRIFTRVGAA
DDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLANKIK
ALTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAALAG
VPKEVIKRARQKLRELESISPNAAATQVDGTQMSLLSVPEETSPAVEALENLDPDSLTPR
QALEWIYRLKSLV