Protein Info for ECD_02573 in Escherichia coli BL21

Annotation: hydrogenase 3, membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 44 to 67 (24 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 114 to 144 (31 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 318 to 348 (31 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details amino acids 411 to 435 (25 residues), see Phobius details amino acids 455 to 480 (26 residues), see Phobius details amino acids 500 to 521 (22 residues), see Phobius details amino acids 587 to 605 (19 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 124 to 404 (281 residues), 131.7 bits, see alignment E=1.6e-42

Best Hits

Swiss-Prot: 100% identical to HYCC_ECOLI: Formate hydrogenlyase subunit 3 (hycC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2723)

MetaCyc: 100% identical to hydrogenase 3 membrane subunit HycC (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]; FHLMULTI-RXN [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 3" in subsystem Formate hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (608 amino acids)

>ECD_02573 hydrogenase 3, membrane subunit (Escherichia coli BL21)
MSAISLINSGVAWFVAAAVLAFLFSFQKALSGWIAGIGGAVGSLYTAAAGFTVLTGAVGV
SGALSLVSYDVQISPLNAIWLITLGLCGLFVSLYNIDWHRHAQVKCNGLQINMLMAAAVC
AVIASNLGMFVVMAEIMALCAVFLTSNSKEGKLWFALGRLGTLLLAIACWLLWQRYGTLD
LRLLDMRMQQLPLGSDIWLLGVIGFGLLAGIIPLHGWVPQAHANASAPAAALFSTVVMKI
GLLGILTLSLLGGNAPLWWGIALLVLGMITAFVGGLYALMEHNIQRLLAYHTLENIGIIL
LGLGAGVTGIALEQPALIALGLVGGLYHLLNHSLFKSVLFLGAGSVWFRTGHRDIEKLGG
IGKKMPVISIAMLVGLMAMAALPPLNGFAGEWVIYQSFFKLSNSGAFVARLLGPLLAVGL
AITGALAVMCMAKVYGVTFLGAPRTKEAENATCAPLLMSVSVVALAICCVIGGVAAPWLL
PMLSAAVPLPLEPANTTVSQPMITLLLIACPLLPFIIMAICKGDRLPSRSRGAAWVCGYD
HEKSMVITAHGFAMPVKQAFAPVLKLRKWLNPVSLVPGWQCEGSALLFRRMALVELAVLV
VIIVSRGA