Protein Info for ECD_02557 in Escherichia coli BL21

Annotation: sorbitol-inducible srl operon transcriptional repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF08220: HTH_DeoR" amino acids 6 to 61 (56 residues), 75.7 bits, see alignment E=2.9e-25 PF08279: HTH_11" amino acids 6 to 50 (45 residues), 31.7 bits, see alignment 1.7e-11 PF00455: DeoRC" amino acids 74 to 231 (158 residues), 177 bits, see alignment E=4.4e-56

Best Hits

Swiss-Prot: 100% identical to SRLR_ECOLI: Glucitol operon repressor (srlR) from Escherichia coli (strain K12)

KEGG orthology group: K02468, DeoR family transcriptional regulator, glucitol operon repressor (inferred from 100% identity to eco:b2707)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>ECD_02557 sorbitol-inducible srl operon transcriptional repressor (Escherichia coli BL21)
MKPRQRQAAILEYLQKQGKCSVEELAQYFDTTGTTIRKDLVILEHAGTVIRTYGGVVLNK
EESDPPIDHKTLINTHKKELIAEAAVSFIHDGDSIILDAGSTVLQMVPLLSRFNNITVMT
NSLHIVNALSELDNEQTILMPGGTFRKKSASFHGQLAENAFEHFTFDKLFMGTDGIDLNA
GVTTFNEVYTVSKAMCNAAREVILMADSSKFGRKSPNVVCSLESVDKLITDAGIDPAFRQ
ALEEKGIDVIITGESNE