Protein Info for ECD_02537 in Escherichia coli BL21

Annotation: putative L-valine exporter, norvaline resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 205 to 237 (33 residues), see Phobius details PF03591: AzlC" amino acids 24 to 164 (141 residues), 131.5 bits, see alignment E=1.4e-42

Best Hits

Swiss-Prot: 100% identical to YGAZ_ECOLI: Inner membrane protein YgaZ (ygaZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2682)

MetaCyc: 100% identical to L-valine exporter, YgaZ component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-269

Predicted SEED Role

"FIG00638108: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>ECD_02537 putative L-valine exporter, norvaline resistance protein (Escherichia coli BL21)
MESPTPQPAPGSATFMEGCKDSLPIVISYIPVAFAFGLNATRLGFSPLESVFFSCIIYAG
ASQFVITAMLAAGSSLWIAALTVMAMDVRHVLYGPSLRSRIIQRLQKSKTALWAFGLTDE
VFAAATAKLVRNNRRWSENWMIGIAFSSWSSWVFGTVIGAFSGSGLLQGYPAVEAALGFM
LPALFMSFLLASFQRKQSLCVTAALVGALAGVTLFSIPVAILAGIVCGCLTALIQAFWQG
APDEL