Protein Info for ECD_02523 in Escherichia coli BL21

Annotation: tributyltin-inducible repressor of ygaVP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 PF12840: HTH_20" amino acids 21 to 70 (50 residues), 30.4 bits, see alignment E=8.2e-11 PF01022: HTH_5" amino acids 23 to 70 (48 residues), 50.6 bits, see alignment E=3.5e-17 PF13412: HTH_24" amino acids 25 to 68 (44 residues), 33.6 bits, see alignment E=5.7e-12 PF01047: MarR" amino acids 26 to 74 (49 residues), 26.6 bits, see alignment E=1.1e-09 PF12802: MarR_2" amino acids 27 to 74 (48 residues), 37.4 bits, see alignment E=5.7e-13

Best Hits

Swiss-Prot: 100% identical to YGAV_ECOLI: Probable HTH-type transcriptional regulator YgaV (ygaV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2667)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (99 amino acids)

>ECD_02523 tributyltin-inducible repressor of ygaVP (Escherichia coli BL21)
MTELAQLQASAEQAAALLKAMSHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLA
RMRDEGLIDSQRDAQRILYSIKNEAVNAIIATLKNVYCP