Protein Info for ECD_02501 in Escherichia coli BL21

Annotation: UPF0053 family inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details PF01595: CNNM" amino acids 1 to 154 (154 residues), 153.9 bits, see alignment E=5.4e-49 PF00571: CBS" amino acids 248 to 296 (49 residues), 28 bits, see alignment 3.3e-10 PF03471: CorC_HlyC" amino acids 314 to 388 (75 residues), 69 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 100% identical to YFJD_ECOLI: UPF0053 inner membrane protein YfjD (yfjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ebd:ECBD_1074)

Predicted SEED Role

"Hemolysins and related proteins containing CBS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>ECD_02501 UPF0053 family inner membrane protein (Escherichia coli BL21)
MTLNRYRLRHMAKQGNRSAKRVEKLLRKPDHLISLVLIGNNLVNILASALGTIVGMRLYG
DAGVAIATGVLTFVVLVFAEVLPKTIAALYPEKVAYPSSFLLAPLLILMMPLVWLLNAIT
RMLMRMMGIKTDIVVSGSLSKEELRTIVHESRSQISRRNQDMLLSVLDLEKMTVDDIMVP
RSEIIGIDINDDWKSILRQLSHSPHGRIVLYRDSLDDAISMLRVREAWRLMSEKKEFTKE
TMLRAADEIYFVPEGTPLSTQLVKFQRNKKKVGLVVNEYGDIQGLVTVEDILEEIVGDFT
TSMSPTLAEEVTPQNDGSVIIDGTANVREINKAFNWHLPEDDARTVNGVILEALEEIPVA
GTRVRIGEYDIDILDVQDNMIKQVKVFPVKPLRESVAE