Protein Info for ECD_02500 in Escherichia coli BL21

Annotation: cytochrome c assembly protein family inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 13 to 22 (10 residues), see Phobius details amino acids 24 to 46 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 61 to 286 (226 residues), 164 bits, see alignment E=2e-52

Best Hits

Swiss-Prot: 100% identical to YPJD_ECOL6: Inner membrane protein YpjD (ypjD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 99% identity to sfx:S2848)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>ECD_02500 cytochrome c assembly protein family inner membrane protein (Escherichia coli BL21)
MQRLEQRSPDAILLLFLIAQTVDITMPVFALLALVAYSVSLALIVPGLLQKNGGWRRMAI
ISAVIALVCHAIALEARILPDGDSGQNLSLLNVGSLVSLMICTVMTIVASRNRGWLLLPI
VYAFALINLALATFMPNEYITHLEATPGMLVHIGLSLFSYATLIIAALYALQLAWIDYQL
KNKKLAFNQEMPPLMSIERKMFHITQIGVVLLTLTLCTGLFYMHNLFSMENIDKAVLSIV
AWFVYIVLLWGHYHEGWRGRRVVWFNVAGAVILTLAYFGSRIVQQLIS