Protein Info for ECD_02497 in Escherichia coli BL21

Annotation: ribosome maturation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR02273: 16S rRNA processing protein RimM" amino acids 14 to 182 (169 residues), 208.6 bits, see alignment E=2e-66 PF01782: RimM" amino acids 16 to 96 (81 residues), 96.8 bits, see alignment E=1.1e-31 PF05239: PRC" amino acids 104 to 177 (74 residues), 43 bits, see alignment E=5.7e-15 PF24986: PRC_RimM" amino acids 108 to 181 (74 residues), 45.2 bits, see alignment E=9.1e-16

Best Hits

Swiss-Prot: 100% identical to RIMM_ECO57: Ribosome maturation factor RimM (rimM) from Escherichia coli O157:H7

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 100% identity to eco:b2608)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>ECD_02497 ribosome maturation factor (Escherichia coli BL21)
MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQL
ESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTE
GYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDP
GF