Protein Info for ECD_02494 in Escherichia coli BL21

Annotation: OM lipoprotein putative positive effector of YfiN activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00691: OmpA" amino acids 55 to 151 (97 residues), 65.3 bits, see alignment E=2.8e-22

Best Hits

Swiss-Prot: 99% identical to YFIB_ECOLI: Putative lipoprotein YfiB (yfiB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b2605)

Predicted SEED Role

"Integral membrane protein YfiB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>ECD_02494 OM lipoprotein putative positive effector of YfiN activity (Escherichia coli BL21)
MIKHLVAPLIFTSLILTGCQSPQGKFTPEQVAAMQSYGFTESAGDWSLGLSDAILFAKND
YKLLPESQQQIQTMAAKLASTGLTHARMDGHTDNYGEDSYNEGLSLKRANVVADAWAMGG
QIPRSNLTTQGLGKKYPIASNKTAQGRAENRRVAVVITTP