Protein Info for ECD_02472 in Escherichia coli BL21

Annotation: cysteine and O-acetylserine exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 107 to 133 (27 residues), see Phobius details amino acids 138 to 164 (27 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details PF01810: LysE" amino acids 14 to 194 (181 residues), 53 bits, see alignment E=1.6e-18

Best Hits

Swiss-Prot: 100% identical to EAMB_ECOHS: Cysteine/O-acetylserine efflux protein (eamB) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K11249, cysteine/O-acetylserine efflux protein (inferred from 100% identity to eco:b2578)

MetaCyc: 100% identical to cysteine/O-acetylserine exporter EamB (Escherichia coli K-12 substr. MG1655)
RXN0-1923; RXN0-1924

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>ECD_02472 cysteine and O-acetylserine exporter (Escherichia coli BL21)
MTPTLLSAFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGI
SFSLAVIDPAAVHLLSWAGAAYIVWLSWKIATSPTKEDGLQAKPISFWASFALQFVNVKI
ILYGVTALSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNI
VLALLLVYCAVRIFY