Protein Info for ECD_02448 in Escherichia coli BL21

Annotation: sensor protein kinase regulating glmY sRNA in two-component system with response regulator GlrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 175 to 198 (24 residues), see Phobius details PF00672: HAMP" amino acids 192 to 244 (53 residues), 22.6 bits, see alignment 1.7e-08 PF00512: HisKA" amino acids 250 to 316 (67 residues), 61.9 bits, see alignment E=7.4e-21 PF02518: HATPase_c" amino acids 362 to 470 (109 residues), 73.8 bits, see alignment E=2.3e-24

Best Hits

Swiss-Prot: 100% identical to QSEE_ECO57: Sensor histidine kinase QseE (qseE) from Escherichia coli O157:H7

KEGG orthology group: K07711, two-component system, NtrC family, sensor histidine kinase YfhK [EC: 2.7.13.3] (inferred from 100% identity to eco:b2556)

MetaCyc: 100% identical to histidine kinase GlrK (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Putative sensor-like histidine kinase YfhK" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>ECD_02448 sensor protein kinase regulating glmY sRNA in two-component system with response regulator GlrR (Escherichia coli BL21)
MKRWPVFPRSLRQLVMLAFLLILLPLLVLAWQAWQSLNALSDQAALVNRTTLIDARRSEA
MTNAALEMERSYRQYCVLDDPTLAKVYQSQRKRYSEMLDAHAGVLPDDKLYQALRQDLNN
LAQLQCNNSGPDAAAAARLEAFASANTEMVQATRTVVFSRGQQLQREIAERGQYFGWQSL
VLFLVSLVMVLLFTRMIIGPVKNIERMINRLGEGRSLGNSVSFSGPSELRSVGQRILWLS
ERLSWLESQRHQFLRHLSHELKTPLASMREGTELLADQVVGPLTPEQKEVVSILDSSSRN
LQKLIEQLLDYNRKQADSAVELENVELAPLVETVVSAHSLPARAKMMHTDVDLKATACLA
EPMLLMSVLDNLYSNAVHYGAESGNICLRSSLHGARVYIDVINTGTPIPQEERAMIFEPF
FQGSHQRKGAVKGSGLGLSIARDCIRRMQGELYLVDESGQDVCFRIELPSSKNTK