Protein Info for ECD_02446 in Escherichia coli BL21

Annotation: response regulator regulating glmY sRNA in two-component system with sensor protein GlrK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF00072: Response_reg" amino acids 9 to 117 (109 residues), 109.3 bits, see alignment E=2.3e-35 PF00158: Sigma54_activat" amino acids 136 to 302 (167 residues), 245.4 bits, see alignment E=5.1e-77 PF14532: Sigma54_activ_2" amino acids 138 to 307 (170 residues), 78.4 bits, see alignment E=1.3e-25 PF07728: AAA_5" amino acids 160 to 276 (117 residues), 26.4 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 100% identical to GLRR_ECOLI: Transcriptional regulatory protein GlrR (glrR) from Escherichia coli (strain K12)

KEGG orthology group: K07715, two-component system, NtrC family, response regulator YfhA (inferred from 100% identity to eco:b2554)

Predicted SEED Role

"Putative sensory histidine kinase YfhA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>ECD_02446 response regulator regulating glmY sRNA in two-component system with sensor protein GlrK (Escherichia coli BL21)
MSHKPAHLLLVDDDPGLLKLLGLRLTSEGYSVVTAESGAEGLRVLNREKVDLVISDLRMD
EMDGMQLFAEIQKVQPGMPVIILTAHGSIPDAVAATQQGVFSFLTKPVDKDALYQAIDDA
LEQSAPATDERWREAIVTRSPLMLRLLEQARLVAQSDVSVLINGQSGTGKEIFAQAIHNA
SPRNSKPFIAINCGALPEQLLESELFGHARGAFTGAVSNREGLFQAAEGGTLFLDEIGDM
PAPLQVKLLRVLQERKVRPLGSNRDIDINVRIISATHRDLPKAMARGEFREDLYYRLNVV
SLKIPALAERTEDIPLLANHLLRQAAERHKPFVRAFSTDAMKRLMTASWPGNVRQLVNVI
EQCVALTSSPVISDALVEQALEGENTALPTFVEARNQFELNYLRKLLQITKGNVTHAARM
AGRNRTEFYKLLSRHELDANDFKE