Protein Info for ECD_02440 in Escherichia coli BL21

Annotation: putative sugar ABC transporter periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 32 to 312 (281 residues), 61.1 bits, see alignment E=1.2e-20 PF13407: Peripla_BP_4" amino acids 41 to 294 (254 residues), 115.8 bits, see alignment E=2.5e-37

Best Hits

Swiss-Prot: 99% identical to YPHF_ECOLI: ABC transporter periplasmic-binding protein YphF (yphF) from Escherichia coli (strain K12)

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 99% identity to eco:b2548)

Predicted SEED Role

"Predicted sugar ABC transport system, periplasmic binding protein YphF precursor" in subsystem Unknown sugar utilization (cluster yphABCDEFG)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ECD_02440 putative sugar ABC transporter periplasmic binding protein (Escherichia coli BL21)
MPKKMRTTRNLLLMATLLGSALFARAADKEMTIGAIYLDTQGYYAGVRQGVQDAAKDSSV
QVQLIETNAQGDISKESTFVDTLVARNVDAIILSAVSENGSSRTVRRASEAGIPVICYNT
CINQKGVDKYVSAYLVGDPLEFGKKLGNAAADYFIANKIDQPKIAVINCEAFEVCVQRRK
GFEEVLKSRVPGAQIVANQEGTVLDKAISVGEKLIISTPDLNAIMGESGGATLGAVKAVR
NQNQAGKIAVFGSDMTTEIAQELENNQVLKAVVDISGKKMGNAVFAQTLKVINKQADGEK
VIQVPIDLYTKTEDGKQWLATHVDGLP