Protein Info for ECD_02438 in Escherichia coli BL21

Annotation: putative sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 306 to 323 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 55 to 316 (262 residues), 125.7 bits, see alignment E=9.7e-41

Best Hits

Swiss-Prot: 100% identical to YPHD_ECOLI: Probable ABC transporter permease protein YphD (yphD) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to eco:b2546)

MetaCyc: 40% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Predicted sugar ABC transport system, permease protein YphD" in subsystem Unknown sugar utilization (cluster yphABCDEFG)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>ECD_02438 putative sugar ABC transporter permease (Escherichia coli BL21)
MSASSLPLPQGKSVSLKQFVSRHINEIGLLVVIAILYLVFSLNAPGFISLNNQMNVLRDA
ATIGIAAWAMTLIIISGEIDVSVGPMVAFVSVCLAFLLQFEVPLAVACLLVLLLGALMGT
LAGVLRGVFNVPSFVATLGLWSALRGMGLFMTNALPVPIDENEVLDWLGGQFLGVPVSAL
IMIVLFALFVFISRKTAFGRSVFAVGGNATAAQLCGINVRRVRILIFTLSGLLAAVTGIL
LAARLGSGNAGAANGLEFDVIAAVVVGGTALSGGRGSLFGTLLGVLVITLIGNGLVLLGI
NSFFQQVVRGVIIVVAVLANILLTQRSSKAKR