Protein Info for ECD_02428 in Escherichia coli BL21

Annotation: putative 3-phenylpropionic transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details amino acids 292 to 316 (25 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 356 to 372 (17 residues), see Phobius details TIGR00902: MFS transporter, phenyl propionate permease (PPP) family" amino acids 1 to 379 (379 residues), 707 bits, see alignment E=3.5e-217 PF12832: MFS_1_like" amino acids 8 to 358 (351 residues), 176.2 bits, see alignment E=1.7e-55 PF01306: LacY_symp" amino acids 9 to 366 (358 residues), 50.5 bits, see alignment E=2.3e-17 PF07690: MFS_1" amino acids 9 to 316 (308 residues), 56.8 bits, see alignment E=2.8e-19

Best Hits

Swiss-Prot: 100% identical to HCAT_ECOLI: Probable 3-phenylpropionic acid transporter (hcaT) from Escherichia coli (strain K12)

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 100% identity to eco:b2536)

Predicted SEED Role

"Probable 3-phenylpropionic acid transporter" in subsystem Cinnamic Acid Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>ECD_02428 putative 3-phenylpropionic transporter (Escherichia coli BL21)
MVLQSTRWLALGYFTYFFSYGIFLPFWSVWLKGIGLTPETIGLLLGAGLVARFLGSLLIA
PRVSDPSRLIFALRVLALLTLLFAVAFWAGAHVAWLMLVMIGFNLFFSPLVPLTDALANT
WQKQFPLDYGKVRLWGSVAFVIGSALTGKLVTMFDYRVILALLTLGVASMLLGFLIRPTI
QPQGASRQQESTGWSAWLALVRQNWRFLACVCLLQGAHAAYYGFSAIYWQAAGYSASAVG
YLWSLGVVAEVIIFALSNKLFRRCSARDMLLISAICGVVRWGIMGATTALPWLIVVQILH
CGTFTVCHLAAMRYIAARQGSEVIRLQAVYSAVAMGGSIAIMTVFAGFLYQYLGHGVFWV
MALVALPAMFLRPKVVPSC