Protein Info for ECD_02423 in Escherichia coli BL21

Annotation: isc operon transcriptional repressor; suf operon transcriptional activator; oxidative stress- and iron starvation-inducible; autorepressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR02010: iron-sulfur cluster assembly transcription factor IscR" amino acids 1 to 134 (134 residues), 220 bits, see alignment E=8.3e-70 TIGR00738: Rrf2 family protein" amino acids 1 to 131 (131 residues), 156.5 bits, see alignment E=3.3e-50 PF02082: Rrf2" amino acids 3 to 132 (130 residues), 131.9 bits, see alignment E=8.9e-43

Best Hits

Swiss-Prot: 100% identical to ISCR_ECOK1: HTH-type transcriptional regulator IscR (iscR) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 100% identity to eco:b2531)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>ECD_02423 isc operon transcriptional repressor; suf operon transcriptional activator; oxidative stress- and iron starvation-inducible; autorepressor (Escherichia coli BL21)
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRG
PGGGYLLGKDASSIAVGEVISAVDESVDATRCQGKGGCQGGDKCLTHALWRDLSDRLTGF
LNNITLGELVNNQEVLDVSGRQHTHDAPRTRTQDAIDVKLRA