Protein Info for ECD_02414 in Escherichia coli BL21

Annotation: rhodanase-like enzyme, sulfur transfer from thiosulfate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF07179: SseB" amino acids 8 to 119 (112 residues), 94.7 bits, see alignment E=5e-31 PF14581: SseB_C" amino acids 137 to 243 (107 residues), 108.4 bits, see alignment E=2.2e-35

Best Hits

Swiss-Prot: 100% identical to SSEB_ECOLI: Protein SseB (sseB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2522)

Predicted SEED Role

"Protein SseB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>ECD_02414 rhodanase-like enzyme, sulfur transfer from thiosulfate (Escherichia coli BL21)
MSETKNELEDLLEKAATEPAHRPAFFRTLLESTVWVPGTAAQGEAVVEDSALDLQHWEKE
DGTSVIPFFTSLEALQQAVEDEQAFVVMPVRTLFEMTLGETLFLNAKLPTGKEFMPREIS
LLIGEEGNPLSSQEILEGGESLILSEVAEPPAQMIDSLTTLFKTIKPVKRAFICSIKENE
EAQPNLLIGIEADGDIEEIIQATGSVATDTLPGDEPIDICQVKKGEKGISHFITEHIAPF
YERRWGGFLRDFKQNRII