Protein Info for ECD_02343 in Escherichia coli BL21

Annotation: ethanolamine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 55 to 81 (27 residues), see Phobius details amino acids 94 to 106 (13 residues), see Phobius details amino acids 120 to 146 (27 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 369 to 392 (24 residues), see Phobius details PF04346: EutH" amino acids 3 to 391 (389 residues), 439 bits, see alignment E=7.3e-136

Best Hits

Swiss-Prot: 99% identical to EUTH_ECOLI: Ethanolamine utilization protein EutH (eutH) from Escherichia coli (strain K12)

KEGG orthology group: K04023, ethanolamine transporter (inferred from 99% identity to eco:b2452)

Predicted SEED Role

"Ethanolamine permease" in subsystem Ethanolamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>ECD_02343 ethanolamine transporter (Escherichia coli BL21)
MGINEIIMYIMMFFMLIAAVDRILSQFGGSARFLGKFGKSIEGSGGQFEEGFMAMGALGL
AMVGMTALAPVLAHVLGPVIIPVYEMLGANPSMFAGTLLACDMGGFFLAKELAGGDVAAW
LYSGLILGSMMGPTIVFSIPVALGIIEPSDRRYLALGVLAGIVTIPIGCIAGGLVAMYSG
VQINGQPVEFTFALILMNMIPVLIVAVLVALGLKFIPEKMINGFQIFAKFLVALITLGLA
AAVVKFLLGWELIPGLDPIFMAPGDKPGEVMRAIEVIGSISCVLLGAYPMVLLLTRWFEK
PLMSVGKLLNMNNIAAAGMVATLANNIPMFGMMKQMDTRGKVINCAFAVSAAFALGDHLG
FAAANMNAMIFPMIVGKLIGGVTAIGVAMMLVPKEDATTTKTEAEAQS