Protein Info for ECD_02281 in Escherichia coli BL21

Annotation: acetyl-CoA:oxalate CoA-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 171 to 188 (18 residues), see Phobius details PF02515: CoA_transf_3" amino acids 11 to 356 (346 residues), 384.5 bits, see alignment E=2.9e-119

Best Hits

Swiss-Prot: 100% identical to ACOCT_ECOLI: Acetyl-CoA:oxalate CoA-transferase (yfdE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2371)

MetaCyc: 100% identical to acetyl-CoA:oxalate CoA-transferase (Escherichia coli K-12 substr. MG1655)
RXN0-7075 [EC: 2.8.3.19]

Predicted SEED Role

"YfdE protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>ECD_02281 acetyl-CoA:oxalate CoA-transferase (Escherichia coli BL21)
MTNNESKGPFEGLLVIDMTHVLNGPFGTQLLCNMGARVIKVEPPGHGDDTRTFGPYVDGQ
SLYYSFINHGKESVVLDLKNDHDKSIFINMLKQADVLAENFRPGTMEKLGFSWETLQEIN
PRLIYASSSGFGHTGPLKDAPAYDTIIQAMSGIMMETGYPDAPPVRVGTSLADLCGGVYL
FSGIVSALYGREKSQRGAHVDIAMFDATLSFLEHGLMAYIATGKSPQRLGNRHPYMAPFD
VFNTQDKPITICCGNDKLFSALCQALELTELVNDPRFSSNILRVQNQAILKQYIERTLKT
QAAEVWLARIHEVGVPVAPLLSVAEAIKLPQTQARNMLIEAGGIMMPGNPIKISGCADPH
VMPGAATLDQHGEQIRQEFSS