Protein Info for ECD_02255 in Escherichia coli BL21

Annotation: N5-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR03533: protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific" amino acids 13 to 295 (283 residues), 461.9 bits, see alignment E=7.6e-143 TIGR00536: methyltransferase, HemK family" amino acids 14 to 303 (290 residues), 364.4 bits, see alignment E=3.5e-113 PF06325: PrmA" amino acids 130 to 207 (78 residues), 31.8 bits, see alignment E=4.8e-11 PF01209: Ubie_methyltran" amino acids 130 to 182 (53 residues), 22.3 bits, see alignment 3.3e-08 PF05175: MTS" amino acids 132 to 215 (84 residues), 56.4 bits, see alignment E=1.3e-18 PF09445: Methyltransf_15" amino acids 135 to 209 (75 residues), 27.3 bits, see alignment E=1.1e-09 PF13847: Methyltransf_31" amino acids 135 to 268 (134 residues), 36.5 bits, see alignment E=1.9e-12 PF13649: Methyltransf_25" amino acids 136 to 216 (81 residues), 38.8 bits, see alignment E=5.7e-13

Best Hits

Swiss-Prot: 100% identical to PRMB_SHIDS: 50S ribosomal protein L3 glutamine methyltransferase (prmB) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K07320, putative adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 99% identity to eco:b2330)

MetaCyc: 99% identical to ribosomal protein L3 N5-glutamine methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1241 [EC: 2.1.1.298]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.298 or 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>ECD_02255 N5-glutamine methyltransferase (Escherichia coli BL21)
MDKIFVDEAVNELQTIQDMLRWSVSRFSAANIWYGHGTDNPWDEAVQLVLPSLYLPLDIP
EDMRTARLTSSEKHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGEL
INNKFAGLISKQPQHILDMCTGSGCIAIACAYAFPEAEVDAVDISPDALAVAEQNIEEHG
LIHNVIPIRSDLFRDLPKVQYDLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKL
TRRILGNAADYLADDGVLICEVGNSMVHLMEQYPDVPFTWLEFDNGGDGVFMLTKEQLLA
AREYFAIYKD