Protein Info for ECD_02241 in Escherichia coli BL21

Annotation: acetyl-CoA carboxylase, beta (carboxyltransferase) subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 117 to 134 (18 residues), see Phobius details TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit" amino acids 1 to 281 (281 residues), 504.7 bits, see alignment E=3.7e-156 PF17848: Zn_ribbon_ACC" amino acids 24 to 49 (26 residues), 48.2 bits, see alignment (E = 1e-16) PF01039: Carboxyl_trans" amino acids 54 to 270 (217 residues), 73.4 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 100% identical to ACCD_ECOSM: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 100% identity to eco:b2316)

MetaCyc: 100% identical to acetyl-CoA carboxyltransferase subunit beta (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>ECD_02241 acetyl-CoA carboxylase, beta (carboxyltransferase) subunit (Escherichia coli BL21)
MSWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNR
LHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPV
VAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKT
SAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREK
LPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNPEAPREGVVVPPVPDQ
EPEA