Protein Info for ECD_02182 in Escherichia coli BL21

Annotation: undecaprenyl phosphate-alpha-L-ara4FN deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF01522: Polysacc_deac_1" amino acids 15 to 168 (154 residues), 38.2 bits, see alignment E=6.3e-14

Best Hits

Swiss-Prot: 100% identical to ARND_ECOLC: Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (arnD) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K13014, undecaprenyl phosphate-alpha-L-ara4FN deformylase [EC: 3.5.-.-] (inferred from 100% identity to eco:b2256)

Predicted SEED Role

"Polymyxin resistance protein PmrJ, predicted deacetylase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Isozymes

Compare fitness of predicted isozymes for: 3.5.-.-

Use Curated BLAST to search for 3.5.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>ECD_02182 undecaprenyl phosphate-alpha-L-ara4FN deformylase (Escherichia coli BL21)
MTKVGLRIDVDTFRGTREGVPRLLEILSKHNIQASIFFSVGPDNMGRHLWRLVKPQFLWK
MLRSNAASLYGWDILLAGTAWPGKEIGHANADIIREAAKHHEVGLHAWDHHAWQARSGNW
DRQTMIDDIARGLRTLEEIIGQPVTCSAAAGWRADQKVIEAKEAFHLRYNSDCRGAMPFR
PLLESGNPGTAQIPVTLPTWDEVIGRDVKAEDFNGWLLNRILRDKGTPVYTIHAEVEGCA
YQHNFVDLLKRAAQEGVTFCPLSELLSETLPLGQVVRGNIAGREGWLGCQQIAGSR