Protein Info for ECD_02179 in Escherichia coli BL21

Annotation: uridine 5'-(beta-1-threo-pentapyranosyl-4-ulose diphosphate) aminotransferase, PLP-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF01041: DegT_DnrJ_EryC1" amino acids 18 to 380 (363 residues), 465.8 bits, see alignment E=2.2e-143 PF01053: Cys_Met_Meta_PP" amino acids 38 to 212 (175 residues), 34.5 bits, see alignment E=1.8e-12 PF00155: Aminotran_1_2" amino acids 41 to 169 (129 residues), 36.4 bits, see alignment E=7.4e-13 PF00266: Aminotran_5" amino acids 50 to 285 (236 residues), 25.6 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 100% identical to ARNB_ECOLI: UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (arnB) from Escherichia coli (strain K12)

KEGG orthology group: K07806, UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC: 2.6.1.87] (inferred from 100% identity to ebr:ECB_02179)

MetaCyc: 100% identical to UDP-4-amino-4-deoxy-L-arabinose aminotransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1863 [EC: 2.6.1.87, 2.6.1.92]

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.- or 2.6.1.87 or 2.6.1.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>ECD_02179 uridine 5'-(beta-1-threo-pentapyranosyl-4-ulose diphosphate) aminotransferase, PLP-dependent (Escherichia coli BL21)
MAEGKAMSEFLPFSRPAMGVEELAAVKEVLESGWITTGPKNQALEQAFCQLTGNQHAIAV
SSATAGMHITLMALKIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAI
ESAITPRTKAIIPVHYAGAPADIDAIRAIGERYGIAVIEDAAHAVGTYYKGRHIGAKGTA
IFSFHAIKNITCAEGGLIVTDNENLARQLRMLKFHGLGVDAYDRQTWGRAPQAEVLTPGY
KYNLTDINAAIALTQLVKLEHLNTRRREIAQQYQQALAALPFQPLSLPAWPHVHAWHLFI
IRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPTLSLPNTEWNSERICS
LPLFPDMTTADADHVITALQQLAGQ