Protein Info for ECD_02175 in Escherichia coli BL21

Annotation: inactive PncC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR00200: competence/damage-inducible protein CinA N-terminal domain" amino acids 1 to 399 (399 residues), 641.6 bits, see alignment E=4.8e-197 TIGR00177: molybdenum cofactor synthesis domain" amino acids 2 to 167 (166 residues), 129.6 bits, see alignment E=9.2e-42 PF00994: MoCF_biosynth" amino acids 6 to 170 (165 residues), 116.5 bits, see alignment E=4.1e-38

Best Hits

Swiss-Prot: 100% identical to CINAL_ECOLC: CinA-like protein (EcolC_1400) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K03742, competence/damage-inducible protein CinA (inferred from 100% identity to eco:b2249)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>ECD_02175 inactive PncC family protein (Escherichia coli BL21)
MLKVEMLSTGDEVLHGQIVDTNAAWLADFFFHQGLPLSRRNTVGDNLDDLVTILRERSQH
ADVLIVNGGLGPTSDDLSALAAATAKGEGLVLHEAWLKEMERYFHERGRVMAPSNRKQAE
LPASAEFINNPVGTACGFAVQLNRCLMFFTPGVPSEFKVMVEHEILPRLRERFSLPQPPV
CLRLTTFGRSESDLAQSLDTLQLPPGVTMGYRSSMPIIELKLTGPASEQQAMEKLWLDVK
RVAGQSVIFEGTEGLPAQISRELQNRQFSLTLSEQFTGGLLALQLSRAGAPLLACEVVPS
QEETLAQTAHWITERRANHFAGLALAVSGFENEHLNFALATPDGTFALRVRFSTTRYSLA
IRQEVCAMMALNMLRRWLNGQDIASEHGWIEVVESMTLSV