Protein Info for ECD_02172 in Escherichia coli BL21

Annotation: putative L-rhamnonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 54 to 74 (21 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 361 to 383 (23 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 381 (360 residues), 159.7 bits, see alignment E=4.9e-51

Best Hits

Swiss-Prot: 100% identical to RHMT_ECOLI: Inner membrane transport protein RhmT (rhmT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2246)

Predicted SEED Role

"Inner membrane transport protein YfaV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>ECD_02172 putative L-rhamnonate transporter (Escherichia coli BL21)
MSTALLDAVVKKNRVRLIPFMLALYVLAFLDRSNIGFAKQTYQIDTGLSNEAYALGAGIF
FVVYAFLGVPANLLMRKLGARTWIGTTTLLWGFLSAAMAWADTEAKFLIVHTLLGAAEAG
FFPGMIYLTSQWFPQRNRASIMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFV
IEGLLAVGAGVFTFFWLDDTPEQARFLSKQEKTLLINQLASEEQQKVTSRLSDALRNGRV
WQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVTAIPWVAALFGTWLIPRYSD
KTGERRNVAALTLLAAGIGIGLSGLLSPVMAIVALCVAAIGFIAVQPVFWTMPTQLLSGT
ALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLLTLAAVAVIGSLIIFTLRVNRT
VAQTDVAHH