Protein Info for ECD_02158 in Escherichia coli BL21

Annotation: bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 16 to 234 (219 residues), 303.4 bits, see alignment E=4.3e-95 PF01209: Ubie_methyltran" amino acids 47 to 157 (111 residues), 38 bits, see alignment E=6.9e-13 PF08003: Methyltransf_9" amino acids 55 to 169 (115 residues), 24.2 bits, see alignment E=8.5e-09 PF05175: MTS" amino acids 56 to 127 (72 residues), 27.5 bits, see alignment E=1.2e-09 PF06325: PrmA" amino acids 57 to 159 (103 residues), 25.5 bits, see alignment E=4.9e-09 PF13847: Methyltransf_31" amino acids 57 to 161 (105 residues), 56.9 bits, see alignment E=1.2e-18 PF02353: CMAS" amino acids 57 to 184 (128 residues), 33.2 bits, see alignment E=1.9e-11 PF13489: Methyltransf_23" amino acids 57 to 170 (114 residues), 89 bits, see alignment E=1.6e-28 PF05401: NodS" amino acids 58 to 182 (125 residues), 24.7 bits, see alignment E=1e-08 PF13649: Methyltransf_25" amino acids 60 to 153 (94 residues), 70.2 bits, see alignment E=1.1e-22 PF08242: Methyltransf_12" amino acids 61 to 154 (94 residues), 59.1 bits, see alignment E=3.5e-19 PF08241: Methyltransf_11" amino acids 61 to 157 (97 residues), 77.5 bits, see alignment E=5.5e-25

Best Hits

Swiss-Prot: 100% identical to UBIG_ECOLC: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to eco:b2232)

MetaCyc: 100% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>ECD_02158 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase (Escherichia coli BL21)
MNAEKSPENHNVDHEEIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERAGGLFGKKV
LDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQVDYVQETVEEHAAKHA
GQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGDVFFSTLNRNGKSWLMAVVGAEYILRM
VPKGTHDVKKFIKPAELLGWVDQTSLKERHITGLHYNPITNTFKLGPGVDVNYMLHTQNK