Protein Info for ECD_02148 in Escherichia coli BL21

Annotation: acetyl-CoA:acetoacetyl-CoA transferase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02429: 3-oxoacid CoA-transferase, A subunit
  • amino acids 6 to 217 (212 residues), 217.9 bits, E=5.7e-69
• PF01144: CoA_trans
  • amino acids 6 to 215 (210 residues), 243.4 bits, E=8.7e-77

Best Hits

Swiss-Prot: 100% identical to ATOD_ECOLI: Acetate CoA-transferase subunit alpha (atoD) from Escherichia coli (strain K12)

KEGG orthology group: K01034, acetate CoA-transferase alpha subunit [EC: 2.8.3.8] (inferred from 100% identity to eco:b2221)

MetaCyc: 100% identical to acetyl-CoA:acetoacetyl-CoA transferase subunit alpha (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Acetyl-CoA:acetoacetyl-CoA transferase, alpha subunit (EC 2.8.3.8)" in subsystem Acetyl-CoA fermentation to Butyrate (EC 2.8.3.8)

MetaCyc Pathways

• acetoacetate degradation (to acetyl CoA) (2/2 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• pyruvate fermentation to acetone (3/5 steps found)
• 4-aminobutanoate degradation V (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• L-glutamate degradation XI (reductive Stickland reaction) (2/7 steps found)
• succinate fermentation to butanoate (2/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Butanoate metabolism
• Propanoate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.8

Use Curated BLAST to search for 2.8.3.8

Protein Sequence (220 amino acids)

>ECD_02148 acetyl-CoA:acetoacetyl-CoA transferase, alpha subunit (Escherichia coli BL21)
MKTKLMTLQDATGFFRDGMTIMVGGFMGIGTPSRLVEALLESGVRDLTLIANDTAFVDTG
IGPLIVNGRVRKVIASHIGTNPETGRRMISGEMDVVLVPQGTLIEQIRCGGAGLGGFLTP
TGVGTVVEEGKQTLTLDGKTWLLERPLRADLALIRAHRCDTLGNLTYQLSARNFNPLIAL
AADITLVEPDELVETGELQPDHIVTPGAVIDHIIVSQESK