Protein Info for ECD_02147 in Escherichia coli BL21

Annotation: fused response regulator of ato operon, in two-component system with AtoS: response regulator/sigma54 interaction protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF00072: Response_reg" amino acids 7 to 115 (109 residues), 109.6 bits, see alignment E=2.9e-35 PF00158: Sigma54_activat" amino acids 145 to 311 (167 residues), 252.3 bits, see alignment E=6e-79 PF14532: Sigma54_activ_2" amino acids 146 to 316 (171 residues), 74.8 bits, see alignment E=2.5e-24 PF07728: AAA_5" amino acids 169 to 287 (119 residues), 27.5 bits, see alignment E=8.4e-10 PF00004: AAA" amino acids 169 to 287 (119 residues), 21.9 bits, see alignment E=6.4e-08 PF02954: HTH_8" amino acids 415 to 454 (40 residues), 52.6 bits, see alignment 9.5e-18

Best Hits

Swiss-Prot: 100% identical to ATOC_ECOLI: Regulatory protein AtoC (atoC) from Escherichia coli (strain K12)

KEGG orthology group: K07714, two-component system, NtrC family, response regulator AtoC (inferred from 100% identity to eco:b2220)

Predicted SEED Role

"Acetoacetate metabolism regulatory protein AtoC" in subsystem Acetyl-CoA fermentation to Butyrate or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>ECD_02147 fused response regulator of ato operon, in two-component system with AtoS: response regulator/sigma54 interaction protein (Escherichia coli BL21)
MTAINRILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPE
MDGIKALKEMRSHETRTPVILMTAYAEVETAVEALRCGAFDYVIKPFDLDELNLIVQRAL
QLQSMKKEIRHLHQALSTSWQWGHILTNSPAMMDICKDTAKIALSQASVLISGESGTGKE
LIARAIHYNSRRAKGPFIKVNCAALPESLLESELFGHEKGAFTGAQTLRQGLFERANEGT
LLLDEIGEMPLVLQAKLLRILQEREFERIGGHQTIKVDIRIIAATNRDLQAMVKEGTFRE
DLFYRLNVIHLILPPLRDRREDISLLANHFLQKFSSENQRDIIDIDPMAMSLLTAWSWPG
NIRELSNVIERAVVMNSGPIIFSEDLPPQIRQPVCNAGEVKTAPVGERNLKEEIKRVEKR
IIMEVLEQQEGNRTRTALMLGISRRALMYKLQEYGIDPADV