Protein Info for ECD_02129 in Escherichia coli BL21

Annotation: quinol dehydrogenase, electron source for NapAB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details TIGR02161: periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family" amino acids 11 to 194 (184 residues), 350.3 bits, see alignment E=1.3e-109 PF03264: Cytochrom_NNT" amino acids 22 to 193 (172 residues), 272.1 bits, see alignment E=4.5e-85

Best Hits

Swiss-Prot: 100% identical to NAPC_ECO57: Cytochrome c-type protein NapC (napC) from Escherichia coli O157:H7

KEGG orthology group: K02569, cytochrome c-type protein NapC (inferred from 100% identity to eco:b2202)

MetaCyc: 54% identical to NapC (Aliivibrio fischeri)
RXN-15816 [EC: 7.1.1.8]

Predicted SEED Role

"Cytochrome c-type protein NapC" in subsystem Nitrate and nitrite ammonification or trimethylamine N-oxide (TMAO) reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>ECD_02129 quinol dehydrogenase, electron source for NapAB (Escherichia coli BL21)
MGNSDRKPGLIKRLWKWWRTPSRLALGTLLLIGFVGGIVFWGGFNTGMEKANTEEFCISC
HEMRNTVYQEYMDSVHYNNRSGVRATCPDCHVPHEFVPKMIRKLKASKELYGKIFGVIDT
PQKFEAHRLTMAQNEWRRMKDNNSQECRNCHNFEYMDTTAQKSVAAKMHDQAVKDGQTCI
DCHKGIAHKLPDMREVEPGF