Protein Info for ECD_02126 in Escherichia coli BL21

Annotation: heme export ABC transporter permease; CcmE-interacting protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 6 to 184 (179 residues), 149.7 bits, see alignment E=4.8e-48 TIGR01191: heme exporter protein CcmC" amino acids 45 to 225 (181 residues), 281.9 bits, see alignment E=1.2e-88

Best Hits

Swiss-Prot: 100% identical to CCMC_SHIFL: Heme exporter protein C (ccmC) from Shigella flexneri

KEGG orthology group: K02195, heme exporter protein C (inferred from 100% identity to eco:b2199)

MetaCyc: 100% identical to cytochrome c maturation protein C (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>ECD_02126 heme export ABC transporter permease; CcmE-interacting protein (Escherichia coli BL21)
MWKTLHQLAIPPRLYQICGWFIPWLAIASVVVLTVGWIWGFGFAPADYQQGNSYRIIYLH
VPAAIWSMGIYASMAVAAFIGLVWQMKMANLAVAAMAPIGAVFTFIALVTGSAWGKPMWG
TWWVWDARLTSELVLLFLYVGVIALWHAFDDRRLAGRAAGILVLIGVVNLPIIHYSVEWW
NTLHQGSTRMQQSIDPAMRSPLRWSIFGFLLLSATLTLMRMRNLILLMEKRRPWVSELIL
KRGRK