Protein Info for ECD_01985 in Escherichia coli BL21

Annotation: UPF0339 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF07411: DUF1508" amino acids 11 to 57 (47 residues), 77.1 bits, see alignment E=3.9e-26 amino acids 61 to 108 (48 residues), 75.6 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 100% identical to YEGP_SHIFL: UPF0339 protein YegP (yegP) from Shigella flexneri

KEGG orthology group: K09946, hypothetical protein (inferred from 99% identity to ecz:ECS88_2179)

Predicted SEED Role

"FIG00638559: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>ECD_01985 UPF0339 family protein (Escherichia coli BL21)
MAGWFELSKSSDNQFRFVLKAGNGETILTSELYTSKASAEKGIASVRSNSPQEERYEKKT
ASNGKFYFNLKAANHQIIGSSQMYATAQSRETGIASVKANGTSQTVKDNT