Protein Info for ECD_01971 in Escherichia coli BL21

Annotation: deoxycytidine triphosphate deaminase; dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 TIGR02274: deoxycytidine triphosphate deaminase" amino acids 2 to 190 (189 residues), 224.7 bits, see alignment E=3.4e-71 PF06559: DCD_N" amino acids 3 to 155 (153 residues), 35.6 bits, see alignment E=1.3e-12 PF22769: DCD" amino acids 4 to 162 (159 residues), 133.4 bits, see alignment E=1.2e-42

Best Hits

Swiss-Prot: 100% identical to DCD_ECOSM: dCTP deaminase (dcd) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to ecx:EcHS_A2205)

MetaCyc: 99% identical to dCTP deaminase (Escherichia coli K-12 substr. MG1655)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>ECD_01971 deoxycytidine triphosphate deaminase; dCTP deaminase (Escherichia coli BL21)
MRLCDRDIEAWLDEGRLSINPRPPVERINGATVDVRLGNKFRTFRGHTAAFIDLSGPKDE
VSAALDRVMSDEIVLDESEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMV
HVTAHRIDPGWSGCIVLEFYNSGKLPLALRPGMLIGALSFEPLSGPAARPYNRREDAKYR
NQQGAVASRIDKD