Protein Info for ECD_01950 in Escherichia coli BL21

Annotation: putative glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR04005: colanic acid biosynthesis glycosyltransferase WcaL" amino acids 1 to 406 (406 residues), 878.6 bits, see alignment E=2.6e-269 PF20706: GT4-conflict" amino acids 170 to 388 (219 residues), 43.6 bits, see alignment E=5.2e-15 PF00534: Glycos_transf_1" amino acids 215 to 382 (168 residues), 133.2 bits, see alignment E=1.9e-42 PF13692: Glyco_trans_1_4" amino acids 225 to 366 (142 residues), 101.1 bits, see alignment E=1.7e-32 PF13524: Glyco_trans_1_2" amino acids 244 to 391 (148 residues), 27.8 bits, see alignment E=5.7e-10

Best Hits

Swiss-Prot: 98% identical to WCAL_ECOLI: Putative colanic acid biosynthesis glycosyltransferase WcaL (wcaL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ebd:ECBD_1611)

Predicted SEED Role

"Colanic acid biosynthesis glycosyl transferase WcaL" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>ECD_01950 putative glycosyl transferase (Escherichia coli BL21)
MKVGFFLLKFPLSSETFVLNQITAFIDMGFEVEIVALQKGDTQNTHAAWTKYNLAARTRW
LQDEPQGKVAKLRHRASQTLRGIHRKNTWQALNLKRYGAESRNLILSAICGQVATPFHAD
VFIAHFGPAGVTAAKLRELGVIRGKIATIFHGIDISSREVLNHYTPEYQQLFRRGDLMLP
ISNLWAGRLQKMGCPREKIAVSRMGVDMTRFSPRPVKAPATPLEIISVARLTEKKGLHVA
IEACRQLKEQGVAFRYRILGIGPWERRLRTLIEQYQLEDVIEMPGFKPSHEVKAMLDDAD
VFLLPSVTGADGDMEGIPVALMEAMAVGIPVVSTLHSGIPELVEADKSGWLVPENDACAL
AQRLAAFSQLDTDELTTVVKRAREKVEHDFNQQVINRELASLLQAL