Protein Info for ECD_01922 in Escherichia coli BL21

Annotation: bifunctional histidinal dehydrogenase/ histidinol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF00815: Histidinol_dh" amino acids 28 to 427 (400 residues), 552.3 bits, see alignment E=3.7e-170 TIGR00069: histidinol dehydrogenase" amino acids 36 to 426 (391 residues), 537.2 bits, see alignment E=1.5e-165

Best Hits

Swiss-Prot: 99% identical to HISX_ECOL6: Histidinol dehydrogenase (hisD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 99% identity to eco:b2020)

MetaCyc: 99% identical to histidinal/histidinol dehydrogenase (Escherichia coli K-12 substr. MG1655)
Histidinol dehydrogenase. [EC: 1.1.1.23]

Predicted SEED Role

"Histidinol dehydrogenase (EC 1.1.1.23)" in subsystem Histidine Biosynthesis (EC 1.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>ECD_01922 bifunctional histidinal dehydrogenase/ histidinol dehydrogenase (Escherichia coli BL21)
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKTRGDEALREYSAKFDK
TTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMARRVAEAVERQLAELPRAETARQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKVGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA