Protein Info for ECD_01899 in Escherichia coli BL21

Annotation: L,D-transpeptidase linking Lpp to murein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03734: YkuD" amino acids 96 to 230 (135 residues), 85.1 bits, see alignment E=7.3e-28 PF17969: Ldt_C" amino acids 234 to 302 (69 residues), 84.2 bits, see alignment E=8.4e-28

Best Hits

Swiss-Prot: 100% identical to ERFK_ECOLI: Probable L,D-transpeptidase ErfK/SrfK (erfK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1990)

MetaCyc: 100% identical to L,D-transpeptidase LdtA (Escherichia coli K-12 substr. MG1655)
RXN0-5401

Predicted SEED Role

"L,D-transpeptidase ErfK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>ECD_01899 L,D-transpeptidase linking Lpp to murein (Escherichia coli BL21)
MRRVNILCSFALLFASHTSLAVTYPLPPEGSRLVGQSFTVTVPDHNTQPLETFAAQYGQG
LSNMLEANPGADVFLPKSGSQLTIPQQLILPDTVRKGIVVNVAEMRLYYYPPDSNTVEVF
PIGIGQAGRETPRNWVTTVERKQEAPTWTPTPNTRREYAKRGESLPAFVPAGPDNPMGLY
AIYIGRLYAIHGTNANFGIGLRVSQGCIRLRNDDIKYLFDNVPVGTRVQIIDQPVKYTTE
PDGSNWLEVHEPLSRNRAEYESDRKVPLPVTPSLRAFINGQEVDVNRANAALQRRSGMPV
QISSGSRQMF