Protein Info for ECD_01890 in Escherichia coli BL21

Annotation: anti-repressor for DgsA(Mlc)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF06167: Peptidase_M90" amino acids 12 to 243 (232 residues), 207 bits, see alignment E=1.8e-65

Best Hits

Swiss-Prot: 100% identical to MTFA_SHISS: Protein MtfA (mtfA) from Shigella sonnei (strain Ss046)

KEGG orthology group: K09933, hypothetical protein (inferred from 99% identity to eco:b1976)

MetaCyc: 99% identical to Mlc titration factor (Escherichia coli K-12 substr. MG1655)
3.4.11.-

Predicted SEED Role

"FIG01220476: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>ECD_01890 anti-repressor for DgsA(Mlc) (Escherichia coli BL21)
MIKWPWKVQESAHQTALPWQEALSIPLLTGLTEQEQSKLVTLAERFLQQKRLVPLQGFEL
DSLRSCRIALLFCLPVLELGLEWLDGFHEVLIYPAPFVVDDEWEDDIGLVHNQRIVQSGQ
SWQQGPIVLNWLDIQDSFDASGFNLIIHEVAHKLDTRNGDRASGVPFIPLREVAGWEHDL
HAAMNNIQEEIELVGENAASIDAYAASDPAECFAVLSEYFFSAPELFAPRFPSLWQRFCQ
FYQQDPLLRLHHANDTDSFSATNVH