Protein Info for ECD_01887 in Escherichia coli BL21

Annotation: inner membrane heme subunit for periplasmic YedYZ reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 9 to 9 (1 residues), see Phobius details transmembrane" amino acids 10 to 30 (21 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details PF01794: Ferric_reduct" amino acids 47 to 161 (115 residues), 60.5 bits, see alignment E=8.9e-21

Best Hits

Swiss-Prot: 100% identical to MSRQ_ECOSE: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Escherichia coli (strain SE11)

KEGG orthology group: None (inferred from 99% identity to eco:b1972)

MetaCyc: 99% identical to membrane-bound flavocytochrome MsrQ (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>ECD_01887 inner membrane heme subunit for periplasmic YedYZ reductase (Escherichia coli BL21)
MRLTAKQVTWLKVSLHLAGLLPFLWLVWAINHGGLGADPVKDIQHFTGRTALKFLLATLL
ITPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGVNNLALLGKELITRPYLTL
GIISWVILLALAFTSTQAMQRKLGKHWQQLHNFVYLVAILAPIHYLWSVKIISPQPLIYA
GLALLLLALRYKKLRSLFNRLRKQVHNKLSV