Protein Info for ECD_01885 in Escherichia coli BL21

Annotation: hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02962: hydroxyisourate hydrolase" amino acids 27 to 137 (111 residues), 150.2 bits, see alignment E=1.3e-48 PF00576: Transthyretin" amino acids 29 to 136 (108 residues), 133.5 bits, see alignment E=2.3e-43

Best Hits

Swiss-Prot: 99% identical to HIUH_ECO57: 5-hydroxyisourate hydrolase (hiuH) from Escherichia coli O157:H7

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 98% identity to eoi:ECO111_2549)

MetaCyc: 99% identical to hydroxyisourate hydrolase / transthyretin-related protein (Escherichia coli K-12 substr. MG1655)
Hydroxyisourate hydrolase. [EC: 3.5.2.17]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>ECD_01885 hydroxyisourate hydrolase (Escherichia coli BL21)
MLKRYLVLSVATAAFSLPSLVYAAQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQL
NTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHY
HVPLLLSQYGYSTYRGS