Protein Info for ECD_01867 in Escherichia coli BL21

Annotation: L-arabinose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 58 to 315 (258 residues), 142 bits, see alignment E=1.1e-45

Best Hits

Swiss-Prot: 100% identical to ARAH_ECOLI: L-arabinose transport system permease protein AraH (araH) from Escherichia coli (strain K12)

KEGG orthology group: K10538, L-arabinose transport system permease protein (inferred from 100% identity to eco:b4460)

MetaCyc: 100% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose transport system permease protein (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>ECD_01867 L-arabinose ABC transporter permease (Escherichia coli BL21)
MSSVSTSGSGAPKSSFSFGRIWDQYGMLVVFAVLFIACAIFVPNFATFINMKGLGLAISM
SGMVACGMLFCLASGDFDLSVASVIACAGVTTAVVINLTESLWIGVAAGLLLGVLCGLVN
GFVIAKLKINALITTLATMQIVRGLAYIISDGKAVGIEDESFFALGYANWFGLPAPIWLT
VACLIIFGLLLNKTTFGRNTLAIGGNEEAARLAGVPVVRTKIIIFVLSGLVSAIAGIILA
SRMTSGQPMTSIGYELIVISACVLGGVSLKGGIGKISYVVAGILILGTVENAMNLLNISP
FAQYVVRGLILLAAVIFDRYKQKAKRTV