Protein Info for ECD_01841 in Escherichia coli BL21

Annotation: carboxy-SAM synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00740: tRNA (cmo5U34)-methyltransferase
  • amino acids 4 to 242 (239 residues), 453.2 bits, E=1.1e-140
• PF00891: Methyltransf_2
  • amino acids 50 to 167 (118 residues), 33.4 bits, E=9.2e-12
• PF01209: Ubie_methyltran
  • amino acids 54 to 165 (112 residues), 23.5 bits, E=9.7e-09
• PF13847: Methyltransf_31
  • amino acids 56 to 165 (110 residues), 38 bits, E=4.2e-13
• PF13649: Methyltransf_25
  • amino acids 60 to 158 (99 residues), 56.2 bits, E=1.4e-18
• PF08242: Methyltransf_12
  • amino acids 62 to 160 (99 residues), 42.5 bits, E=2.7e-14
• PF08241: Methyltransf_11
  • amino acids 62 to 162 (101 residues), 44 bits, E=9e-15

Best Hits

Swiss-Prot: 100% identical to CMOA_ECOL5: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to eco:b1870)

MetaCyc: 100% identical to carboxy-S-adenosyl-L-methionine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-7066

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (247 amino acids)

>ECD_01841 carboxy-SAM synthase (Escherichia coli BL21)
MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQRSVPGYSNIISMIGMLAERFVQPGTQV
YDLGCSLGAATLSVRRNIHHDNCKIIAIDNSPAMIERCRRHIDAYKAPTPVDVIEGDIRD
IAIENASMVVLNFTLQFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNM
HHDFKRANGYSELEISQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVA
LKAEDAA