Protein Info for ECD_01775 in Escherichia coli BL21

Annotation: acyl-CoA synthetase (long-chain-fatty-acid--CoA ligase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 29 to 419 (391 residues), 334.3 bits, E=9.1e-104
• PF13193: AMP-binding_C
  • amino acids 469 to 543 (75 residues), 67.7 bits, E=1.4e-22

Best Hits

Swiss-Prot: 100% identical to LCFA_ECOL6: Long-chain-fatty-acid--CoA ligase (fadD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 100% identity to eco:b1805)

MetaCyc: 100% identical to long-chain-fatty-acid--CoA ligase monomer (Escherichia coli BL21(DE3))
6.2.1.-; 6.2.1.-

Predicted SEED Role

"Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)" in subsystem Biotin biosynthesis or n-Phenylalkanoic acid degradation (EC 6.2.1.3)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• oleate β-oxidation (32/35 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• 5,6-dehydrokavain biosynthesis (engineered) (8/10 steps found)
• fatty acid salvage (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• long-chain fatty acid activation (1/1 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis IV (4/6 steps found)
• γ-linolenate biosynthesis II (animals) (1/2 steps found)
• cinnamoyl-CoA biosynthesis (1/2 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• phosphatidylcholine acyl editing (2/4 steps found)
• phytol degradation (2/4 steps found)
• alkane biosynthesis II (1/3 steps found)
• oleate biosynthesis I (plants) (1/3 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
• long chain fatty acid ester synthesis (engineered) (1/4 steps found)
• pinosylvin metabolism (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• 3-methyl-branched fatty acid α-oxidation (2/6 steps found)
• 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• octane oxidation (1/5 steps found)
• 2-deoxy-D-ribose degradation II (3/8 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (1/7 steps found)
• capsaicin biosynthesis (1/7 steps found)
• ceramide degradation by α-oxidation (1/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (2/10 steps found)
• sporopollenin precursors biosynthesis (5/18 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (2/16 steps found)
• cutin biosynthesis (2/16 steps found)
• suberin monomers biosynthesis (3/20 steps found)

KEGG Metabolic Maps

• Fatty acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.3

Protein Sequence (561 amino acids)

>ECD_01775 acyl-CoA synthetase (long-chain-fatty-acid--CoA ligase) (Escherichia coli BL21)
MKKVWLNRYPADVPTEINPDRYQSLVDMFEQSVARYADQPAFVNMGEVMTFRKLEERSRA
FAAYLQQGLGLKKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDS
GASAIVIVSNFAHTLEKVVDKTAVQHVILTRMGDQLSTAKGTVVNFVVKYIKRLVPKYHL
PDAISFRSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNA
TYGPLLHPGKELVVTALPLYHIFALTINCLLFIELGGQNLLITNPRDIPGLVKELAKYPF
TAITGVNTLFNALLNNKEFQQLDFSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLT
ECAPLVSVNPYDIDYHSGSIGLPVPSTEAKLVDDDDNEVPPGQPGELCVKGPQVMLGYWQ
RPDATDEIIKNGWLHTGDIAVMDEEGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHPGV
QEVAAVGVPSGSSGEAVKIFVVKKDPSLTEESLVTFCRRQLTGYKVPKLVEFRDELPKSN
VGKILRRELRDEARGKVDNKA