Protein Info for ECD_01771 in Escherichia coli BL21

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 260 to 277 (18 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details amino acids 418 to 438 (21 residues), see Phobius details TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 1 to 444 (444 residues), 548.2 bits, see alignment E=7.3e-169 PF02028: BCCT" amino acids 2 to 444 (443 residues), 385.3 bits, see alignment E=1.9e-119

Best Hits

Swiss-Prot: 100% identical to YEAV_ECOLI: Uncharacterized transporter YeaV (yeaV) from Escherichia coli (strain K12)

KEGG orthology group: K03451, betaine/carnitine transporter, BCCT family (inferred from 100% identity to eco:b1801)

MetaCyc: 36% identical to gamma-butyrobetaine transporter (Emergencia timonensis)
TRANS-RXN-497

Predicted SEED Role

"Choline-glycine betaine transporter"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>ECD_01771 putative transporter (Escherichia coli BL21)
MVLLAMGLVIYLATSKYGNIRLGEGKPEYSTLSWLFMFICAGLGSSTLYWGVAEWAYYYQ
TPGLNIAPRSQQALEFSVPYSFFHWGISAWATYTLASLIMAYHFHVRKNKGLSLSGIIAA
ITGVRPQGPWGKLVDLMFLIATVGALTISLVVTAATFTRGLSALTGLPDNFTVQAFVILL
SGGIFCLSSWIGINNGLQRLSKMVGWGAFLLPLLVLIVGPTEFITNSIINAIGLTTQNFL
QMSLFTDPLGDGSFTRNWTVFYWLWWISYTPGVAMFVTRVSRGRKIKEVIWGLILGSTVG
CWFFFGVMESYAIHQFINGVINVPQVLETLGGETAVQQVLMSLPAGKLFLAAYLGVMIIF
LASHMDAVAYTMAATSTRNLQEGDDPDRGLRLFWCVVITLIPLSILFTGASLETMKTTVV
LTALPFLVILLVKVGGFIRWLKQDYADIPAHQVEHYLPQTPVEALEKTPVLPAGTVFKGD
N