Protein Info for ECD_01703 in Escherichia coli BL21

Annotation: phospho-chitobiase; general 6-phospho-beta-glucosidase activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF02056: Glyco_hydro_4" amino acids 6 to 187 (182 residues), 258.4 bits, see alignment E=3.2e-81 PF11975: Glyco_hydro_4C" amino acids 199 to 415 (217 residues), 162 bits, see alignment E=2.1e-51

Best Hits

Swiss-Prot: 99% identical to CHBF_ECOLI: 6-phospho-beta-glucosidase (chbF) from Escherichia coli (strain K12)

KEGG orthology group: K01222, 6-phospho-beta-glucosidase [EC: 3.2.1.86] (inferred from 99% identity to eco:b1734)

MetaCyc: 99% identical to monoacetylchitobiose-6-phosphate hydrolase (Escherichia coli K-12 substr. MG1655)
6-phospho-beta-glucosidase. [EC: 3.2.1.86]; RXN0-7392 [EC: 3.2.1.86]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.86

Use Curated BLAST to search for 3.2.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>ECD_01703 phospho-chitobiase; general 6-phospho-beta-glucosidase activity (Escherichia coli BL21)
MSQKLKVVTIGGGSSYTPELLEGFIKRYHELPVSELWLVDVEGGKAKLDIIFDLCQRMID
NAGVPMKLYKTLDRREALKDADFVTTQLRVGQLPARELDERIPLSHGYLGQETNGAGGLF
KGLRTIPVIFDIVKDVEELCPNAWVINFTNPAGMVTEAVYRHTGFKRFIGVCNIPIGMKM
FIRDVLMLKDSDDLSIDLFGLNHMVFIKDVLVNGKSRFAELLDGVASGQLKASSVKNIFD
LPFSEGLIRSLNLLPCSYLLYYFKQKEMLAIEMGEYYKGGARAQVVQKVEKQLFELYKNP
ELKVKPKELEQRGGAYYSDAACEVINAIYNDKQAEHYVNIPHHGHIDNIPADWAVEMTCK
LGRDGATPHPRITHFDDKVMGLIHTIKGFEIAASNAALSGEFNDVLLALNLSPLVHSDRD
AELLAREMILAHEKWLPNFADCIAELKKAH