Protein Info for ECD_01700 in Escherichia coli BL21

Annotation: cell division modulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 87 PF10729: CedA" amino acids 10 to 85 (76 residues), 153.3 bits, see alignment E=6.4e-50

Best Hits

Swiss-Prot: 100% identical to CEDA_SHIF8: Cell division activator CedA (cedA) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: None (inferred from 98% identity to ecc:c2129)

Predicted SEED Role

"Cell division activator cedA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (87 amino acids)

>ECD_01700 cell division modulator (Escherichia coli BL21)
MRLVKPVMKKPLRQQNRQIISYVPRTEPAPPEHAIKMDSFRDVWMLRGKYVAFVLMGESF
LRSPAFTVPESAQRWANQIRQEGEVTE