Protein Info for ECD_01697 in Escherichia coli BL21

Annotation: inner membrane protein regulated by LexA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 31 to 48 (18 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details PF04307: YdjM" amino acids 1 to 158 (158 residues), 122.3 bits, see alignment E=8.4e-40

Best Hits

Swiss-Prot: 100% identical to YDJM_SHIFL: Inner membrane protein YdjM (ydjM) from Shigella flexneri

KEGG orthology group: K07038, inner membrane protein (inferred from 100% identity to eco:b1728)

Predicted SEED Role

"Membrane-bound metal-dependent hydrolase YdjM, induced during SOS response"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>ECD_01697 inner membrane protein regulated by LexA (Escherichia coli BL21)
MTAEGHLLFSIACAVFAKNAELTPVLAQGDWWHIVPSAILTCLLPDIDHPKSFLGQRLKW
ISKPIARAFGHRGFTHSLLAVFALLATFYLKVPESWFIPADALQGMVLGYLSHILADMLT
PAGVPLLWPCRWRFRLPILVPQKGNQLERFICMALFVWSVWMPHSLPENSAVRWSSQMIN
TLQIQFHRLIKHQVEY