Protein Info for ECD_01666 in Escherichia coli BL21

Annotation: putative electron transfer flavoprotein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF01012: ETF" amino acids 28 to 206 (179 residues), 116.7 bits, see alignment E=5.4e-38

Best Hits

Swiss-Prot: 99% identical to YDIQ_ECOLI: Putative electron transfer flavoprotein subunit YdiQ (ydiQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1697)

Predicted SEED Role

"Electron transfer flavoprotein, beta subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>ECD_01666 putative electron transfer flavoprotein subunit (Escherichia coli BL21)
MKIITCFKLVPEEQDIVVTPEYTLNFDNADAKISQFDLNAIEAASQLATDDDEIAALTVG
GSLLQNSKVRKDVLSRGPHSLYMVQDAQLEHALPLDTAKALAAAVEKIGFDLLIFGEGSG
DLYAQQVGLLVGEILQLPVINAVSAIQRQGNTLVIERTLEDDVEVIELSVPAVLCVTSDI
NVPRIPSMKAILGAGIKPVNQWQASDIDWSQSAPLAELVGIRVPPQTERKHIIIDNDSPE
AIAELAEHLKKALN