Protein Info for ECD_01665 in Escherichia coli BL21

Annotation: putative DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF02311: AraC_binding" amino acids 28 to 143 (116 residues), 38.8 bits, see alignment E=1.5e-13 PF07883: Cupin_2" amino acids 30 to 89 (60 residues), 42 bits, see alignment E=1.2e-14 PF12833: HTH_18" amino acids 202 to 281 (80 residues), 74.4 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 99% identical to YDIP_ECOLI: Uncharacterized HTH-type transcriptional regulator YdiP (ydiP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecl:EcolC_1935)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>ECD_01665 putative DNA-binding transcriptional regulator (Escherichia coli BL21)
MYQRCFDNASETLFVAGKTPRLSRFAFSDDPKWESGHHVHDNETELIYVKKGVARFTIDS
SLYVAHADDIVVIERGRLHAVASDVNDPATTCTCALYGFQFQGAEENHLLQPHSCPVIAA
GQGKEVIKTLFNELSVILPQSKNSQTSSLWDAFAYTLAILYYENFKNAYRSEQGYIKKDV
LIKDILFYLNNNYREKITLEQLSKKFRASVSYICHEFTKEYRISPINYVIQRRMTEAKWL
LTNTELSQAEISWRVGYENVDHFGKLFLRHVGCSPSDYRRQFKKCFAEQEILSEFPQPVS
LVG