Protein Info for ECD_01662 in Escherichia coli BL21

Annotation: 3-dehydroquinate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01093: 3-dehydroquinate dehydratase, type I
  • amino acids 17 to 245 (229 residues), 293 bits, E=1.1e-91
• PF01487: DHquinase_I
  • amino acids 20 to 246 (227 residues), 265 bits, E=4.2e-83

Best Hits

Swiss-Prot: 100% identical to AROD_ECOLC: 3-dehydroquinate dehydratase (aroD) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K03785, 3-dehydroquinate dehydratase I [EC: 4.2.1.10] (inferred from 98% identity to eco:b1693)

MetaCyc: 98% identical to 3-dehydroquinate dehydratase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate dehydratase. [EC: 4.2.1.10]

Predicted SEED Role

"3-dehydroquinate dehydratase I (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• gallate biosynthesis (2/3 steps found)
• quinate degradation II (2/3 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• quinate degradation I (1/3 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (4/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (5/42 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.10

Protein Sequence (252 amino acids)

>ECD_01662 3-dehydroquinate dehydratase (Escherichia coli BL21)
MKTVTVKDLVIGAGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVES
VMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTG
DDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSD
VLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVT
DLRTVLTILHQA