Protein Info for ECD_01611 in Escherichia coli BL21

Annotation: outer membrane lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF05433: Rick_17kDa_Anti" amino acids 62 to 102 (41 residues), 30.4 bits, see alignment E=1.5e-11

Best Hits

Swiss-Prot: 100% identical to SLYB_ECO57: Outer membrane lipoprotein SlyB (slyB) from Escherichia coli O157:H7

KEGG orthology group: K06077, outer membrane lipoprotein SlyB (inferred from 100% identity to eco:b1641)

Predicted SEED Role

"Outer membrane lipoprotein pcp precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>ECD_01611 outer membrane lipoprotein (Escherichia coli BL21)
MIKRVLVVSMVGLSLVGCVNNDTLSGDVYTASEAKQVQNVSYGTIVNVRPVQIQGGDDSN
VIGAIGGAVLGGFLGNTVGGGTGRSLATAAGAVAGGVAGQGVQSAMNKTQGVELEIRKDD
GNTIMVVQKQGNTRFSPGQRVVLASNGSQVTVSPR