Protein Info for ECD_01608 in Escherichia coli BL21

Annotation: pyridoxine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 3 to 218 (216 residues), 348.7 bits, see alignment E=5.8e-109 PF01243: Putative_PNPOx" amino acids 39 to 122 (84 residues), 91.7 bits, see alignment E=2.8e-30 PF10590: PNP_phzG_C" amino acids 178 to 218 (41 residues), 70.7 bits, see alignment 7.8e-24

Best Hits

Swiss-Prot: 100% identical to PDXH_ECODH: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 100% identity to eco:b1638)

MetaCyc: 100% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>ECD_01608 pyridoxine 5'-phosphate oxidase (Escherichia coli BL21)
MSDNDELQQIAHLRREYTKGGLRRRDLPADPLTLFERWLSQACEAKLADPTAMVVATVDE
HGQPYQRIVLLKHYDEKGMVFYTNLGSRKAHQIENNPRVSLLFPWHTLERQVMVIGKAER
LSTLEVMKYFHSRPRDSQIGAWVSKQSSRISARGILESKFLELKQKFQQGEVPLPSFWGG
FRVSLEQIEFWQGGEHRLHDRFLYQRENDAWKIDRLAP